Industrial Material
Lyophilized Peptide Long R3 IGF-1 Top Quality IGF-1 LR3 Increase Protein
2017-07-29 04:04  Visit:29
Price:Unfilled
Send inquiry
Model Number: IGF-1 LR3 Brand Name: Biopharm Key Specifications/Special Features: SpecificationName: IGF-1 LR3Synonyms: long r3 IGF-1, LR3 IGF, IGF1 LR3, Long Arg3 IGF-1CAS No.: 946870-92-4Molecular formula: C400H625N111O115S9Molecular mass: 9117.5 Da (g/mol)Amino acid sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSAPurityIGF-1 LR3 has a peptide purity level that exceeds 95.0% as determined by HPLC and MS Product Name IGF-1 LR3 Other Name Long R3 IGF-1 Chemical Name Long Arg3 IGF-1 Abb. Name: LR3 IGF CAS No. 946870-92-4 Molecular Formula C400H625N111O115S9 Product Type Lyophilized Powder Color White Standard Pharmaceutical Grade Package 1 mg/vial
0.1 mg/vial
Shipping Information:
  • FOB Port: Shenzhen
  • Lead Time: 3 - 5 days
  • Dimensions per Unit: 15 × 15 × 15 Centimeters
  • Weight per Unit: 0.5 Kilograms
  • Units per Export Carton: 10
  • Export Carton Dimensions L/W/H: 25 × 25 × 25 Centimeters
  • Export Carton Weight: 1 Kilograms
Main Export Markets:
  • Asia
  • Australasia
  • Central/South America
  • Eastern Europe
  • Mid East/Africa
  • North America
  • Western Europe
Message

TO: farmkemi

E-mail:

Content:

Contact information
Company:Wuhan Pharma Chemical Co., Ltd.
Status:Offline Send a letter
Name:farmkemi(Mr.)
Tel: (86 27) 87711369
Fax: (86 27) 87750287
Area:Beijing
Address:No. 3 Zhongnan Road, Wuchang, Wuhan, Hubei, China (430000)
Zip code:000000
Mail:[email protected]
Linkurl:http://farmkemi.ouerwanju.com/
Comment
0